Obat Alami Untuk Infeksi Telinga Pada Anak

Featured

Obat alami untuk infeksi telinga pada anak – Anak-anak merupakan kelompok umur yang paling rentan terkena infeksi telinga. Bahkan jika mereka terserang pilek, mereka akan berakhir dengan infeksi di telinganya. Alasannya adalah karena sistem kekebalan tubuh anak-anak belum terbentuk sangat baik dan telinga mereka belum sesempurna teliga orang dewasa dalam hal pencegahan masuknya benda asing yang masuk ke dalam telinga.

Obat Alami Untuk Infeksi Telinga Pada AnakInfeksi yang rentan terjadi pada telinga anak adalah infeksi telinga luar.Biasanya terjadi ketika telinga tetap basah dalam waktu yang cukup lama untuk kuman berkembang biak. Selain basah, kapas(ataupun sesuatu yang mereka masukan ke telinga) dapat menyebabkan infeksi telinga. Berhati-hatilah jika anak anda mengeluh telinganya terasa gatal atau sakit jika disentuh. Selain nfeksi yang terjadi pada telinga luar, anak-anak juga bisa terkena infeksi telinga tengah. Pada telinga tengah terdapat tabung eustachius, yaitu sebuah kanal yangmenghubungkan telinga tengah ke tenggorokan. Tabung ini berfungsi untuk menjaga cairan dan tekanan udara yang masuk ke dalam telinga. Penyakit seperti flu, pilek serta alergi dapat mengiritasi tabung eustachius dan menyebabkan tabung ini membengkak.

Gejala utama infeksi telinga adalah nyerio telinga yang tajam. Anak akan merasa tidak nyaman saat berbaring sehingga menyebabkan anak sulit tidur. Selain itu anak juga bisa mengalami gangguan pendengaran, demam, pusing, tredapat cairan mengalir dari telinga, serta hidung yang tersumbat.

Untuk mengetahui secara pasti apakah anak anda terkena infeksi yaitu dengan memeriksakan anak anda ke dokter. Dokter akan memeriksa keadaan anak anda dan akan memerika bagian telinga anak anda. Dokter akan mengetahui jika gendang telinga  yang sehat akan tampak jernih dan berwarna merah muda keabu-abuan. Sedangkan gendang telinga yang terinfeksi akan tampak merah dan membengkak.

Jika anak anda mengalami infeksi pada telinga, kami sarankan untuk mengkonsumsi Jelly Gamat Gold-G obat herbal yang berfungsi tidak hanya sebagai obat, sebagai antiseptik alami yang dapat emmbantu meredakan peradangan serta infeksi yang disebabkan oleh beberapa virus, bakteri serta jamur penyebab penyakit.

Jelly Gamat Gold-G Membantu Mengobati Infeksi Telinga Pada Anak Secara Alami

Obat Alami Untuk Infeksi Telinga Pada AnakSolusi alami untuk mengobati infeksi telinga pada anak anda, kami sarankan dengan mengkonsumsi secara rutin Jelly Gamat Gold-G. Terbuat dari teripang emas yang di ekstrak dan diolah dengan menggunakan teknologi tinggi dan telah melalui serangkaian proses destilasi 4 kali menjadian ekstrak dari teripang emas tersebut menjadi berwarna bening, dan tidak mempunyai rasa. Teripang ynag digunakan mengandung banyak kandungan vitamin dan gizi ytang dibutuhkan oleh tubuh. Seperti kolagen, mineral, protein, omega 3,6, dan 9, vitamin B1 dan B2, saponin, glukosamin, chondroitin dan cell growth factor. Tidak hanya itu, teripang emas ini dipilih karena teripang jenis ini termasuk kedalam satu satunya species yang mengandung Gemapeptide. Gemapeptide ini berfungsi sebagai anti peradangan, mengurangi rasa sakit, 3 kali lebih cepat dalam menyembuhkan luka. Jelly Gamat Gold-G adalah obat herbal yang berbentuk jelli dengan berwarna bening dan memiliki sedikit aroma. Jika anak anda tidak menyukai rasanya yang tawar, bisa dicampur dengan teh, susu, jus dll. Dengan kandungan yang lengkap pada teripang emas Jelly Gamat gold-G, maka anda tidak perlu meragukan khasiat dan manfaat Jelly Gamat Gold-G untuk pengobatan, karena Jelly Gamat Gold-G obat alami untuk infeksi telinga pada anak juga telah terdaftar di BPOM.

Untuk pemesanan Jelly Gamat Gold-G, dapat melalui kami dengan mengirimkan sebuah pesan berisi format seperti berikut ini:

Ketik   ITGHH : Nama Anda : Jumlah Pesanan : Alamat Lengkap : No.Hp/Tlp.

kirim ke 085.223.944.949

  • Contoh: ITGHH : Mulyani : Jl. Perintis Kemerdekaan 145 Tasikmalaya : 081.312.xxxxx kirim ke 085.223.944.949
  • Ingat..!! Cantumkan ITGHH dalam pesan karena merupakan kode produk, jika tidak pemesanan tidak akan kami proses.

“Sebagai agen terbaik, kami melakukan pengiriman barang ke seluruh wilayah Indonesia dengan bantuan pengiriman barang dari Tiki JNE. Selain itu untuk pemesanan 2 botol kebawah, kami akan mengirimkan barang terlebih dahulu, baru setelah barang sampai anda transfer pembayarannya. Akan tetapi jika pemesanan melebihi dari 2 botol, diharuskan untuk membayar setengahnya terlebih dahulu dan setengahnya bisa anda bayar setelah barang diterima.”

Baca juga: Obat Alami Untuk Telinga Berjamur Pada Anak

Advertisements

Legalitas Jelly Gamat Gold-G

Legalitas Jelly Gamat Gold-G,- Seperti telah diketahui, Jelly Gamat Gold-G adalah obat herbal multikhasiat yang terbuat dari 100% bahan alami teripang emas yang diekstrak. Jelly Gamat Gold-G juga telah melalui serangkaian proses yang panjang hingga akhirnya mendapatkan keabsahan atau legalitas. Di berbagai negara bagian Asia, teripang emas sudah dikenal sebagai hewan laut yang dapat memberikan manfaat untuk penyembuhan penyakit dan luka. Dari itu, dengan kemajuan teknologi, kini teripang emas di ekstrak dengan lebih higienis tanpa mengurangi nilai kandungan gizi dan vtamin yang berada di dalamnya.

Untuk mengetahui seperti apa legalitas yang didapatkan Jelly Gamat Gold-G, berikut adalah bukti dari keabsahan tersebut:

Nomor Registrasi TI114645721
Tanggal Terbit 19-12-2011
Diterbitkan Oleh Registrasi Obat Tradisional & Suplemen Makanan
Direktorat Penilaian Obat Tradisional, Suplemen Makanan dan Kosmetika
Produk obat
Klasifikasi Produk Obat Tradisional Impor
Nama Produk Gold-G Sea Cucumber Jelly
Bentuk Sediaan Cairan Obat Dalam
Komposisi – Sea cucumber extract
Merk
Kemasan Botol @ 320 ml
Pendaftar & Importir PT. GNE Indonesia – Jakarta Barat, DKI Jakarta
Produsen Biogene R & D SDN BHD – Malaysia
  1. Legalitas Jelly Gamat Gold-GTelah mendapatkan Sertifikat HALAL dari Malaysia: Jakim (22.00) /492/2/1 010-10/2004
  2. Rekomendasi Sertifikat Badan POM RI ML 114645721
  3. Rekomendasi dari Agri-Food % Veternity Authority of Singapore (AVA) tanggal 11 Oktober 2003 (Semacam Departemen Kesehatan Pemerintahan-Nya Singapura)

Teripang Jelly Gamat Gold-G Diakui Dunia

  • US FDA telah memasukan teripang dalam keluarga FOOD GRACE
  • Australia, telah mengembangkan penggunaan teripang emas untuk dijadikan sebagai obat HIV/AIDS
  • Amerika Serikat dan Australia, menggunakan teripang emas untuk djadikan sebagai obat untuk para atlet dan suplemen untuk mengatasi masalah persendian, osteoporosis dan reumatik
  • Malaysia, Indonesia, Singapura, dan Brunai, yang telah mengenal teripang emas sejak 50 tahun lalu dan digunakan sebagai obat dan tonik untuk pengobatan tradisional. Seperti untuk menghentikan pedarahan pada wanita setelah melahirkan dan mempercepat proses khitan untuk anak laki-laki karena memiliki kandungan Cell Growth Factor yang dapat merehenerasi sel yang telah rusak.
  • China, Jepang dan Korea, menghidangkan teripang untuk para bangsawan. Melbourne menggunakan teripang sebagai sumber proten yang unik.

Demikian adalah bukti dari legalitas jelly gamat gold-g, hal ini dimakasudkan agar anda lebih nyaman dan tidak meragukkan Jelly Gamat Gold-G. Jika tertarik silahkan lakukan pemesanan kepada kami dengan cara sms mengikuti format yang telah ditentukan. Cara pemesananya yang lengkap dapat dilihat disini » Cara Pemesanan Jelly Gamat Gold-G

reposted by : obatalamiinfeksitelingapadaanak.wordpress.com

Cara Mengkonsumsi Jelly Gamat Gold-G

Cara mengkonsumsi Jelly Gamat Gold-G – Untuk mendapatkan penyembuhan yang optimal, perlu diketahui cara mengkonsumsi yang sesuai dengan dosis dan takaran yang tepat. Berikut adalah aturan mengkonsumsi jelly gamat gold-g yang benar:

Untuk menjaga kesehatan, cukup dengan satu sendok makan sekali dalam sehari sebelum tidur

  • Untuk terapi sakit ringan, satu sendok makan 3 kali sehari sebelum makan
  • Untuk terapi sakit sedang, dua sendok makan 3 kali sehari sebelum makan
  • Untuk terapi sakit berat, tiga sendok makan 3 kali sehari sebelum makan
  • Untuk terapi sakit gula / diabetes berat dengan luka, selain diminum, dianjurkan juga diolesi pada luka dengan menggunakan kapas bersih sebanyak 5 kali sehari untuk mempercapatproses penyambuhan luka (luka yang sudah lama maupun baru) agar cepat mengering
  • Untuk penyembuhan luka bekas operasi ataupun luka bakar, cukup dengan dua sendok makan dan 5 kali pengolesan pada luka tersebut.

Agar daya kerja obat lebih cepat, larutkan Jelly Gamat Gold-G kedalam 1 atau 1/2 gelas air putih hangat (200 ml) kemudian aduk hingga benar-benar larut kenudian minum sdampai habis. Cara ini sangat efektif untuk penderita hepatitis, stroke, hipertensi berat dan liver. Selain dicampur sengan air putih hangat, Jelly Gamat Gold-G juga bisa dicampur dengan minuman favorit seperti teh, jus, susu dll. Jelly Gamat Gold-G aman dikonsumsi oleh semua kalangan termasuk anak-anak dan ibu hamil.

Bagaimana cara penyimpanan Jelly Gamat Gold-G yang benar?

Untuk penyimpanannya, agar khasiatnya terjaga dan tidak terkontaminasi bakteri atau jamur dari luar, simpan di lemari pendingin atau kulkas dan tutup rapat tutup botolnya. Atau jika tidak, simpan pada tempat kering dan usahakan terhindar dari paparan sinar matahari.

Seperti itulah cara mengkonsumsi jelly gamat gold-g yang telah disesuaikan dengan seberapa ringan dan beratnya penyakit yang dialami. Semoga bisa bermanfaat untuk anda. 🙂

Obat Alami Untuk Telinga Berjamur Pada Anak

Obat alami untuk telinga berjamur pada anak – Telinga berjamur umumnya bisa terjadi pada siapa saja termasuk anak-anak. Jamur umumnya timbul pada tempat-tempat yang lembab, dan pada umumnya lubang telinga itu kering. Telinga yang berjamur diakibatkan lubang telinga yang lembab sampai basah hingga berair. Hal ini disebabkan oleh infeksi yang terjadi pada rongga telinga luar yang umumnya disebabkan karena terlalu sering membersihkan telinga dengan kapas/cotton bud.

Obat Alami Untuk Telinga Berjamur Pada AnakGejala yang timbul karena telinga berjamur adalah terasa sangat gatal dan jika dibiarkan akan timbul rasa sakit pada telinga dan dapat menyebabkan telinga mengeluarkan cairan.

Perlu diperhatikan, jika ingin membersihkan telinga anak jangan terlalu dalam dan terlalu keras, hingga dapat mengakibatkan lecet pada kulit dan kemudian menjadi lembab dan berair, jika ini berlangsung cukup lama akan berakhir dengan telinga berjamur.

Bagaimanapun mencegah lebih baik daripada mengobati. Tindakan pencegahan yang perlu dilakukan adalah jangan membersihkan telinga terlalu sering dan dalam dengan cotton bud, apalagi membersihkan telinga dengan alat-alat pengait yang terbuat dari besi/logam.

Jika andak anda mengalami telinga berjamur seperti yang telah dijelaskan diatas, anda tidak perlu khawatir untuk pengobatannya. Kami menawarkan solusi terbaik untuk penyembuhan telinga berjamur anak anda. Dengan obat herbal Jelly Gamat Gold-G membantu mengatasi jamur pada telinga dan menghilangkan rasa sakit yang disebabkan oleh pertumbuhan jamur pada telinga anak.

Jelly Gamat Gold-G Membantu Mengatasi Telinga Berjamur Pada Anak

Obat Alami Untuk Telinga Berjamur Pada AnakObat alami untuk telinga berjamur pada anak dari Jelly Gamat Gold-G adalah obat herbal yang terbuat dari ektrak teripang emas yang kaya akan kandungan gizi dan vitamin yang bermanfaat untuk tubuh. Teripang yang digunakan dalam Jelly Gamat Gold-G adalah teripang terpilih yang berasal dari species ‘Golden Stichpus Variegatus’ yang memiliki kandungan Gemapeptide (tidak ditemukan pada teripang jenis lain). Kandungan gemapeptide didalam teripang ini membantu mengurangi rasa sakit pada telinga yang disebabkan jamur dan mencegah peradangan, serta mengobati luka 3 kali lebih cepat dibandingkan dengan antiseptik biasa. Jelly Gamat Gold-G aman dikonsumsi anak-anak, dewasa dan lansia. Jika anak anda tidak menyukai rasa tawar dari Jelly Gamat Gold-G, anda bisa mencampurkannya pada minuman favoritnya seperti teh, susu dan jus.

Untuk pemesanan Jelly Gamat Gold-G bisa melalui sms dengan mengetikan sesuai dengan format yang telah kami tentukan. Cara pemesanan bisa dilihat dengan mengklik gambar dibawah ini:

cara-pembelian-jelly-gamat

“Sebagai agen terbaik, kami melayani pengiriman ke seluruh wilayah Indonesia, dan khusus untuk pemesanan 1-2 botol, kami akan mengirimakn barang terlebih dahulu, barang sampai beru transfer.”

Cara Pemesanan Jelly Gamat Gold-G

Jelly Gamat Gold-G, adalah obat herbal multikhasiat terbuiat dari bahan alami teripang emas ynag diekstrak dan dikemas secara higienis. Telah melalui serangkaian proses destilasi 4 kali menjadikan ekstrak teripang dalam Jelly Gamat Gold-G berwarna bening dan tidak berbau serta tidak mengurangi nilai kandungan gizi dan vitamin yang terdapat didalamnya. Cara pemesanan Jelly Gamat Gold-G bisa melalui sms dengan mengisi format seperti berikut ini:

Ketik ITGHH : Nama Anda : Jumlah Pesanan : Alamat Lengkap : No.Hp/Tlp.

Kirim ke 085.223.944.949

Contoh: ITGHH : Mulyani : Jl. Perintis Kemerdekaan 145 Tasikmalaya : 081.312.xxxxx kirim ke 085.223.944.949

Ingat..!!

  • Cantumkan ITGHH dalam pesan, jika tidak pemesanan tidak akan kami proses

Setelah anda mengirim pesan seperti contoh diatas, tahap selanjutnya adalah kami akan mengirimkan balasan pesan anda dengan mengirimkan jumlah total yang harus anda bayar beserta nomor rekening yang akan digunakan sebagai alat bantu transfer pembayarannya. Untuk pemesanan 2 botol kebawah, kami akan memberikan pelayanan pengiriman barang terlebih dahulu, baru setelah barang sampai anda bisa transfer pembayarannya, tapi jika pemesanan lebih dari 2 botol, diharuskan untuk transfer setenghnya terlebih dahulu dari jumlah total pembayaran dan setengahnya bisa anda selesaikan setelah barang diterima.

Berikut adalah daftar harga Jelly Gamat Gold-G

Pembelian
Harga Retail
Discount
Ongkos Kirim
Harga Net
1 botol 320ml
Rp.180.000,-
Rp.5.000,-
Tarif JNE 1Kg
Rp.175.000,-
2 botol 320ml
Rp.360.000,-
Rp.50.000,-
Tarif JNE 1Kg
Rp.310.000,-
3 botol 320ml
Rp.540.000,-
Rp.70.000,-
Tarif JNE 1Kg
Rp.470.000,-
4 botol 320ml
Rp.720.000,-
Rp.120.000,-
Gratis*
Rp.600.000,-
6 botol  320ml
Rp.1.080.000
Rp.240.000,-
Gratis**
Rp.840.000,-
45 botol 320ml
Rp.4.158.000,-
buku + VCD
Gratis
Rp.4.158.000,-

Tarif Tiki JNE 1 kg kita dapatkan setelah mengetahui alamat lengkap.

Penting untuk anda ketahui..!!

  1. Setiap pembelian jelly gamat gold-g sea cucumbar untuk 4 botol, ongkos kirim gratis, akan tetapi jika ogkos kirim lebih dari Rp. 50.000,00- maka kelebihannya ditanggung pembeli
  2. Setiap pembelian jelly gamat gold-g sea cucumbar untuk 6 botol ongkos kirim gratis,tetapi jika ngkos kirim lebih dari Rp. 100.000,00- maka kelebihannya ditanggung pembeli.
  3. Setiap pembelian jelly gamat gold-g sea cucumbar 45 botol (paket agen) ongkos kirim gratis ditambah buku+CD, perlu diingat pembelian 45 botol jelly gamat gold-g sea cucumbar harganya sewaktu-waktudapat berubah menyesuaikan dengan nlai rupiah pada kurs ringgit Malaysia. “Informasi Harga Pasti” akan langsung kami informasikan setelah anda mengirimkan sms berisi sesuai dengan cara pesan jelly gamat gold-g seperti contoh diatas.

Berikut adalah nama bank beserta nomor rekening yang bisa anda gunakan salah satunya untuk transfer pembayarannya:

Bank BRI Cab. Tasikmalaya
Nomor Rekening: 0100-01-054862-50-5
Atas Nama        : Aryanto

Bank Mandiri KCP Tasikmalaya
Nomor Rekening: 131-00-0994255-0
Atas Nama        : Aryanto

Bank BNI KCU Tasikmalaya
Nomor Rekening: 0226098704
Atas Nama        : Aryanto

Bank BCA KCU Tasikmalaya
Nomor Rekening : 054-0606-196
Atas Nama         : Aryanto

Bank CIMB Niaga Cab. Tasikmalaya
Nomor Rekening : 439-01-01029-11-8
Atas Nama         : Aryanto

Setelah pemesanan sudah benar-benar sampai ke tempat anda, segera lakukan transfer pembayaran dan hubungi kami kembali atau mengirimkan sebuah pesan berisi konfirmasi bahwa produk kami telah sampai ditempat anda. Berikut contoh pesan yang harus anda ikuti untuk tindakan konfirmasi.

Nama : Nama Produk : Jumlah Pesanan : Nominal Transfer : Nama Bank Tujuan : No.Hp/Tlp Kirim ke 085.223.944.949

  • Contoh:  Dina Mariana : Jelly Gamat Gold-G : 2 botol : Rp. 310.000,00- : Bank CIMB Niaga Cab. Tasikmalaya : 081.323.xxxxxx kirim ke 085.223.944.949

Kami adalah agen berpengalaman melakukan pengiriman barang ke seluruh wilayah Indonesia dengan bantuan pengiriman barang Tiki JNE. Semoga pelayanan yang kami berikan membuat anda merasa nyaman.

Terima kasih telah menyimak, semoga bermanfaat.   🙂